SCOP 1.63: Domain d1k4da1: 1k4d A:1-118

Lineage for d1k4da1 (1k4d A:1-118)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab against potassium channel KcsA, (mouse), kappa L chain [69140] (2 PDB entries)

8. Domain d1k4da1: 1k4d A:1-118 [68131]
   Other proteins in same PDB: d1k4da2, d1k4db2, d1k4dc_

Details for d1k4da1

PDB Entry: 1k4d, 2.3 Å

PDB Description: potassium channel kcsa-fab complex in low concentration of k+

SCOP Domain Sequences for d1k4da1:

Sequence; same for both SEQRES and ATOM records:

>d1k4da1 b.1.1.1 (A:1-118) Immunoglobulin (variable domains of L and H chains) {Fab against potassium channel KcsA, (mouse), kappa L chain}
qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvss

Timeline for d1k4da1:

• d1k4da1 first appeared in SCOP 1.59
  
• d1k4da1 appears in SCOP 1.61
  
• d1k4da1 appears in SCOP 1.65
  
• d1k4da1 appears in the current release, SCOPe 2.08