| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) ![]() Pfam PF00520 |
| Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
| Protein Potassium channel protein [56901] (3 species) |
| Species Streptomyces coelicolor [TaxId:1902] [56902] (18 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 Uniprot Q54397 22-124 |
| Domain d1k4cc_: 1k4c C: [68130] Other proteins in same PDB: d1k4ca1, d1k4ca2, d1k4ca3, d1k4cb1, d1k4cb2 residues 22-124 complexed with dga, f09, k |
PDB Entry: 1k4c (more details), 2 Å
SCOPe Domain Sequences for d1k4cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4cc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d1k4cc_: