SCOP 1.61: Domain d1k4cb2: 1k4c B:108-212

Lineage for d1k4cb2 (1k4c B:108-212)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab against potassium channel KcsA, (mouse), kappa L chain [69151] (2 PDB entries)

8. Domain d1k4cb2: 1k4c B:108-212 [68129]
   Other proteins in same PDB: d1k4ca1, d1k4cb1, d1k4cc_

Details for d1k4cb2

PDB Entry: 1k4c, 2 Å

PDB Description: potassium channel kcsa-fab complex in high concentration of k+

SCOP Domain Sequences for d1k4cb2:

Sequence; same for both SEQRES and ATOM records:

>d1k4cb2 b.1.1.2 (B:108-212) Immunoglobulin (constant domains of L and H chains) {Fab against potassium channel KcsA, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d1k4cb2:

• d1k4cb2 first appeared in SCOP 1.59
  
• d1k4cb2 appears in SCOP 1.63
  
• d1k4cb2 appears in the current release, SCOPe 2.08