Lineage for d1k4cb2 (1k4c B:108-212)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104065Species Fab against potassium channel KcsA, (mouse), kappa L chain [69151] (2 PDB entries)
  8. 104067Domain d1k4cb2: 1k4c B:108-212 [68129]
    Other proteins in same PDB: d1k4ca1, d1k4cb1, d1k4cc_

Details for d1k4cb2

PDB Entry: 1k4c (more details), 2 Å

PDB Description: Potassium Channel KcsA-Fab complex in high concentration of K+

SCOP Domain Sequences for d1k4cb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4cb2 b.1.1.2 (B:108-212) Immunoglobulin (constant domains of L and H chains) {Fab against potassium channel KcsA, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1k4cb2:

Click to download the PDB-style file with coordinates for d1k4cb2.
(The format of our PDB-style files is described here.)

Timeline for d1k4cb2: