Lineage for d1k4cb1 (1k4c B:1-107)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653573Domain d1k4cb1: 1k4c B:1-107 [68128]
    Other proteins in same PDB: d1k4ca1, d1k4ca2, d1k4cb2, d1k4cc_
    part of Fab against potassium channel KcsA
    complexed with dga, f09, k; mutant

Details for d1k4cb1

PDB Entry: 1k4c (more details), 2 Å

PDB Description: potassium channel kcsa-fab complex in high concentration of k+
PDB Compounds: (B:) antibody fab fragment light chain

SCOP Domain Sequences for d1k4cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4cb1 b.1.1.1 (B:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleik

SCOP Domain Coordinates for d1k4cb1:

Click to download the PDB-style file with coordinates for d1k4cb1.
(The format of our PDB-style files is described here.)

Timeline for d1k4cb1: