| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
| Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
| Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries) |
| Domain d1k4ca1: 1k4c A:1-118 [68126] Other proteins in same PDB: d1k4ca2, d1k4cb1, d1k4cb2, d1k4cc_ part of Fab against potassium channel KcsA complexed with dga, f09, k; mutant |
PDB Entry: 1k4c (more details), 2 Å
SCOP Domain Sequences for d1k4ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4ca1 b.1.1.1 (A:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvss
Timeline for d1k4ca1: