Lineage for d1k3ia2 (1k3i A:-12-150)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046281Family b.18.1.1: Galactose-binding domain [49786] (2 proteins)
    automatically mapped to Pfam PF00754
  6. 2046282Protein Galactose oxidase, N-terminal domain [49787] (3 species)
  7. 2046287Species Fungus (Fusarium sp.) [TaxId:29916] [69209] (2 PDB entries)
    sequence identical to that of Dactylium dendroides
  8. 2046288Domain d1k3ia2: 1k3i A:-12-150 [68114]
    Other proteins in same PDB: d1k3ia1, d1k3ia3
    complexed with act, ca, glc

Details for d1k3ia2

PDB Entry: 1k3i (more details), 1.4 Å

PDB Description: crystal structure of the precursor of galactose oxidase
PDB Compounds: (A:) Galactose Oxidase Precursor

SCOPe Domain Sequences for d1k3ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3ia2 b.18.1.1 (A:-12-150) Galactose oxidase, N-terminal domain {Fungus (Fusarium sp.) [TaxId: 29916]}
ipegslqflslrasapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangd
pkpphtytidmkttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfad
sttkysnfetrparyvrlvaiteangqpwtsiaeinvfqass

SCOPe Domain Coordinates for d1k3ia2:

Click to download the PDB-style file with coordinates for d1k3ia2.
(The format of our PDB-style files is described here.)

Timeline for d1k3ia2: