Lineage for d1k3ga_ (1k3g A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 209981Protein Cytochrome c6 (synonym: cytochrome c553) [46628] (10 species)
  7. 209992Species Bacillus pasteurii [TaxId:1474] [46629] (5 PDB entries)
  8. 209995Domain d1k3ga_: 1k3g A: [68111]
    complexed with hec

Details for d1k3ga_

PDB Entry: 1k3g (more details)

PDB Description: nmr solution structure of oxidized cytochrome c-553 from bacillus pasteurii

SCOP Domain Sequences for d1k3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3ga_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Bacillus pasteurii}
vdaeavvqqkcischggdltgasapaidkaganyseeeildiilngqggmpggiakgaea
eavaawlaekk

SCOP Domain Coordinates for d1k3ga_:

Click to download the PDB-style file with coordinates for d1k3ga_.
(The format of our PDB-style files is described here.)

Timeline for d1k3ga_: