Lineage for d1k3aa_ (1k3a A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735239Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 735240Species Human (Homo sapiens) [TaxId:9606] [69826] (5 PDB entries)
  8. 735243Domain d1k3aa_: 1k3a A: [68098]
    complexed with acp

Details for d1k3aa_

PDB Entry: 1k3a (more details), 2.1 Å

PDB Description: Structure of the Insulin-like Growth Factor 1 Receptor Kinase
PDB Compounds: (A:) insulin-like growth factor 1 receptor

SCOP Domain Sequences for d1k3aa_:

Sequence, based on SEQRES records: (download)

>d1k3aa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
vpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerief
lneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvlapp
slskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyr
kggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvme
gglldkpdncpdmllelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk

Sequence, based on observed residues (ATOM records): (download)

>d1k3aa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
vpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerief
lneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpempslskmiqm
ageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkggkgllp
vrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpd
ncpdmllelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk

SCOP Domain Coordinates for d1k3aa_:

Click to download the PDB-style file with coordinates for d1k3aa_.
(The format of our PDB-style files is described here.)

Timeline for d1k3aa_: