Lineage for d1k32b4 (1k32 B:680-762,B:854-1061)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310547Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 310548Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 310566Family c.14.1.2: Tail specific protease, catalytic domain [52100] (3 proteins)
    includes N-terminal all-alpha subdomain
  6. 310576Protein Tricorn protease [69436] (1 species)
  7. 310577Species Archaeon Thermoplasma acidophilum [TaxId:2303] [69437] (4 PDB entries)
  8. 310579Domain d1k32b4: 1k32 B:680-762,B:854-1061 [68075]
    Other proteins in same PDB: d1k32a1, d1k32a2, d1k32a3, d1k32b1, d1k32b2, d1k32b3, d1k32c1, d1k32c2, d1k32c3, d1k32d1, d1k32d2, d1k32d3, d1k32e1, d1k32e2, d1k32e3, d1k32f1, d1k32f2, d1k32f3

Details for d1k32b4

PDB Entry: 1k32 (more details), 2 Å

PDB Description: Crystal structure of the tricorn protease

SCOP Domain Sequences for d1k32b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k32b4 c.14.1.2 (B:680-762,B:854-1061) Tricorn protease {Archaeon Thermoplasma acidophilum}
ssiheeflqmydeawklardnywneavakeiseriyekyrnlvplcktrydlsnvivemq
geyrtshsyemggtftdkdpfrsXddrfiryrswveanrryvherskgtigyihipdmgm
mglnefyrlfinessyqglivdvrfngggfvsqliieklmnkrigydnprrgtlspyptn
svrgkiiaitneyagsdgdifsfsfkklglgkligtrtwggvvgitpkrrlidgtvltqp
efafwfrdagfgvenygvdpdveieyaphdylsgkdpqidyaidalieelrn

SCOP Domain Coordinates for d1k32b4:

Click to download the PDB-style file with coordinates for d1k32b4.
(The format of our PDB-style files is described here.)

Timeline for d1k32b4: