| Class b: All beta proteins [48724] (177 folds) |
| Fold b.106: Phage tail proteins [69278] (1 superfamily) core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel |
Superfamily b.106.1: Phage tail proteins [69279] (3 families) ![]() |
| Family b.106.1.1: Baseplate protein-like [69280] (3 proteins) duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions |
| Protein Baseplate structural protein gp27 [69281] (1 species) |
| Species Bacteriophage T4 [TaxId:10665] [69282] (3 PDB entries) |
| Domain d1k28d2: 1k28 D:201-376 [68053] Other proteins in same PDB: d1k28a1, d1k28a2, d1k28a3, d1k28a4 complexed with k, po4 |
PDB Entry: 1k28 (more details), 2.9 Å
SCOPe Domain Sequences for d1k28d2:
Sequence, based on SEQRES records: (download)
>d1k28d2 b.106.1.1 (D:201-376) Baseplate structural protein gp27 {Bacteriophage T4 [TaxId: 10665]}
dmminqepypmivgepsligqfiqelkyplaydfvwltksnphkrdpmknatiyahsfld
ssipmittgkgensivvsrsgaysemtyrngyeeairlqtmaqydgyakcstignfnltp
gvkiifndsknqfktefyvdevihelsnnnsvthlymftnatkletidpvkvknef
>d1k28d2 b.106.1.1 (D:201-376) Baseplate structural protein gp27 {Bacteriophage T4 [TaxId: 10665]}
dmminqepypmivgepskyplaydfvwltksnphkrdpmknatiyahsfldssipmittg
kgensivvsrsgaysemtyrngyeeairlqtmaqydgyakcstignfnltpgvkiifnds
knqfktefyvdevihelsnnnsvthlymftnatkletidpvkvknef
Timeline for d1k28d2:
View in 3DDomains from other chains: (mouse over for more information) d1k28a1, d1k28a2, d1k28a3, d1k28a4 |