Lineage for d1k28d2 (1k28 D:201-376)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1811730Fold b.106: Phage tail proteins [69278] (1 superfamily)
    core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel
  4. 1811731Superfamily b.106.1: Phage tail proteins [69279] (3 families) (S)
  5. 1811732Family b.106.1.1: Baseplate protein-like [69280] (3 proteins)
    duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions
  6. 1811755Protein Baseplate structural protein gp27 [69281] (1 species)
  7. 1811756Species Bacteriophage T4 [TaxId:10665] [69282] (3 PDB entries)
  8. 1811758Domain d1k28d2: 1k28 D:201-376 [68053]
    Other proteins in same PDB: d1k28a1, d1k28a2, d1k28a3
    complexed with k, po4

Details for d1k28d2

PDB Entry: 1k28 (more details), 2.9 Å

PDB Description: The Structure of the Bacteriophage T4 Cell-Puncturing Device
PDB Compounds: (D:) Baseplate structural protein Gp27

SCOPe Domain Sequences for d1k28d2:

Sequence, based on SEQRES records: (download)

>d1k28d2 b.106.1.1 (D:201-376) Baseplate structural protein gp27 {Bacteriophage T4 [TaxId: 10665]}
dmminqepypmivgepsligqfiqelkyplaydfvwltksnphkrdpmknatiyahsfld
ssipmittgkgensivvsrsgaysemtyrngyeeairlqtmaqydgyakcstignfnltp
gvkiifndsknqfktefyvdevihelsnnnsvthlymftnatkletidpvkvknef

Sequence, based on observed residues (ATOM records): (download)

>d1k28d2 b.106.1.1 (D:201-376) Baseplate structural protein gp27 {Bacteriophage T4 [TaxId: 10665]}
dmminqepypmivgepskyplaydfvwltksnphkrdpmknatiyahsfldssipmittg
kgensivvsrsgaysemtyrngyeeairlqtmaqydgyakcstignfnltpgvkiifnds
knqfktefyvdevihelsnnnsvthlymftnatkletidpvkvknef

SCOPe Domain Coordinates for d1k28d2:

Click to download the PDB-style file with coordinates for d1k28d2.
(The format of our PDB-style files is described here.)

Timeline for d1k28d2: