SCOP 1.59: Domain d1k28d1: 1k28 D:4-200

Lineage for d1k28d1 (1k28 D:4-200)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.106: Baseplate structural protein gp27 [69278] (1 superfamily)

4. Superfamily b.106.1: Baseplate structural protein gp27 [69279] (1 family)

5. Family b.106.1.1: Baseplate structural protein gp27 [69280] (1 protein)

6. Protein Baseplate structural protein gp27 [69281] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [69282] (1 PDB entry)

8. Domain d1k28d1: 1k28 D:4-200 [68052]
   Other proteins in same PDB: d1k28a1, d1k28a2, d1k28a3

Details for d1k28d1

PDB Entry: 1k28, 2.9 Å

PDB Description: The Structure of the Bacteriophage T4 Cell-Puncturing Device

SCOP Domain Sequences for d1k28d1:

Sequence; same for both SEQRES and ATOM records:

>d1k28d1 b.106.1.1 (D:4-200) Baseplate structural protein gp27 {Bacteriophage T4}
lqrpgypnlsvklfdsydawsnnrfvelaatittltmrdslygrnegmlqfydsknihtk
mdgneiiqisvanandinnvktriygckhfsvsvdskgdniiaielgtihsienlkfgrp
ffpdagesikemlgviyqdrtlltpainainayvpdipwtstfenylsyvrevalavgsd
kfvfvwqdimgvnmmdy

Timeline for d1k28d1:

• d1k28d1 is new in SCOP 1.59
  
• d1k28d1 appears in SCOP 1.61
  
• d1k28d1 appears in the current release, SCOPe 2.08