SCOPe 2.07: Domain d1k28a3: 1k28 A:130-345

Lineage for d1k28a3 (1k28 A:130-345)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Tail-associated lysozyme gp5, catalytic domain [69629] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [69630] (1 PDB entry)

8. Domain d1k28a3: 1k28 A:130-345 [68051]
   Other proteins in same PDB: d1k28a1, d1k28a2, d1k28a4, d1k28d1, d1k28d2
   complexed with k, po4

Details for d1k28a3

PDB Entry: 1k28, 2.9 Å

PDB Description: The Structure of the Bacteriophage T4 Cell-Puncturing Device

PDB Compounds: (A:) Tail-associated lysozyme

SCOPe Domain Sequences for d1k28a3:

Sequence; same for both SEQRES and ATOM records:

>d1k28a3 d.2.1.3 (A:130-345) Tail-associated lysozyme gp5, catalytic domain {Bacteriophage T4 [TaxId: 10665]}
nvlnqggevgydsssnviqdsnldtainpddrplseiptddnpnmsmaemlrrdeglrlk
vywdtegyptigighlimkqpvrdmaqinkvlskqvgreitgnpgsitmeeattlferdl
admqrdikshskvgpvwqavnrsrqmalenmafqmgvggvakfntmltamlagdwekayk
agrdslwyqqtkgrasrvtmiiltgnlesygvevkt

Timeline for d1k28a3:

• d1k28a3 first appeared in SCOP 1.59
  
• d1k28a3 appears in SCOPe 2.06
  
• d1k28a3 appears in the current release, SCOPe 2.08