Lineage for d1k1sa_ (1k1s A:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339256Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 339257Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 339520Family e.8.1.5: Lesion bypass DNA polymerase (Y-family) [64477] (2 proteins)
  6. 339521Protein DinB homolog (DBH) [64478] (2 species)
  7. 339522Species Archaeon Sulfolobus solfataricus [TaxId:2287] [64479] (3 PDB entries)
  8. 339524Domain d1k1sa_: 1k1s A: [68025]
    mutant

Details for d1k1sa_

PDB Entry: 1k1s (more details), 2.8 Å

PDB Description: Crystal Structure of DinB from Sulfolobus solfataricus

SCOP Domain Sequences for d1k1sa_:

Sequence, based on SEQRES records: (download)

>d1k1sa_ e.8.1.5 (A:) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus}
mivifvdfdyffaqveevlnpqykgkplvvsvysgrtktsgavatanyearklgvkagmp
iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
ideipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepven
kskiphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskgk
kfkhgisidnaykvaedllrellvrdkrrnvrrigvkldniiin

Sequence, based on observed residues (ATOM records): (download)

>d1k1sa_ e.8.1.5 (A:) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus}
mivifvdfdyffaqveevlnpqykgkplvvsvysgtsgavatanyearklgvkagmpiik
amqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfengi
elarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneldide
ipgigsvlarrlnelgiqklrdilsknynelekitgkakalyllklaqnkysepvenksk
iphgryltlpyntrdvkvilpylkkaineaynkvngipmritviaimedldilskgkkfk
hgisidnaykvaedllrellvrdkrrnvrrigvkldniiin

SCOP Domain Coordinates for d1k1sa_:

Click to download the PDB-style file with coordinates for d1k1sa_.
(The format of our PDB-style files is described here.)

Timeline for d1k1sa_: