Lineage for d1k1ca_ (1k1c A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.94: HPr-like [55593] (1 superfamily) Superfamily d.94.1: HPr-like [55594] (1 family) 
Family d.94.1.1: HPr-like [55595] (2 proteins) 
Protein Crh, catabolite repression HPr-like protein [69783] (1 species) Species Bacillus subtilis [TaxId:1423] [69784] (1 PDB entry) 
Domain d1k1ca_: 1k1c A: [67994]
Details for d1k1ca_
PDB Entry: 1k1c (more details)
PDB Description: solution structure of crh, the bacillus subtilis catabolite repression hpr
SCOP Domain Sequences for d1k1ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k1ca_ d.94.1.1 (A:) Crh, catabolite repression HPr-like protein {Bacillus subtilis}
vqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgtev
tliaqgedeqealeklaayvqeev
SCOP Domain Coordinates for d1k1ca_:
Click to download the PDB-style file with coordinates for d1k1ca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k1ca_:
- d1k1ca_ is new in SCOP 1.59
- d1k1ca_ appears in SCOP 1.61
- d1k1ca_ appears in the current release, SCOPe 2.08
View in 3D