SCOP 1.63: Domain d1k0uf1: 1k0u F:190-352

Lineage for d1k0uf1 (1k0u F:190-352)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins)
   this domain interrupts the other domain which defines family

6. Protein S-adenosylhomocystein hydrolase [51845] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [51847] (6 PDB entries)

8. Domain d1k0uf1: 1k0u F:190-352 [67980]
   Other proteins in same PDB: d1k0ua2, d1k0ub2, d1k0uc2, d1k0ud2, d1k0ue2, d1k0uf2, d1k0ug2, d1k0uh2

Details for d1k0uf1

PDB Entry: 1k0u, 3 Å

PDB Description: Inhibition of S-adenosylhomocysteine Hydrolase by "acyclic sugar" Adenosine Analogue D-eritadenine

SCOP Domain Sequences for d1k0uf1:

Sequence; same for both SEQRES and ATOM records:

>d1k0uf1 c.2.1.4 (F:190-352) S-adenosylhomocystein hydrolase {Rat (Rattus norvegicus)}
nlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviiteidpinal
qaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdveidvkw
lnenavekvnikpqvdryllknghriillaegrlvnlgcamgh

Timeline for d1k0uf1:

• d1k0uf1 first appeared in SCOP 1.59
  
• d1k0uf1 appears in SCOP 1.61
  
• d1k0uf1 appears in SCOP 1.65
  
• d1k0uf1 appears in the current release, SCOPe 2.08