Lineage for d1k0rb4 (1k0r B:-4-99)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050576Fold d.202: Transcription factor NusA, N-terminal domain [69704] (1 superfamily)
    alpha-beta(3)-alpha-beta-alpha; bifurcated coiled beta-sheet
  4. 1050577Superfamily d.202.1: Transcription factor NusA, N-terminal domain [69705] (1 family) (S)
  5. 1050578Family d.202.1.1: Transcription factor NusA, N-terminal domain [69706] (1 protein)
  6. 1050579Protein Transcription factor NusA, N-terminal domain [69707] (2 species)
  7. 1050580Species Mycobacterium tuberculosis [TaxId:1773] [69709] (1 PDB entry)
  8. 1050582Domain d1k0rb4: 1k0r B:-4-99 [67968]
    Other proteins in same PDB: d1k0ra1, d1k0ra2, d1k0ra3, d1k0rb1, d1k0rb2, d1k0rb3
    complexed with so4

Details for d1k0rb4

PDB Entry: 1k0r (more details), 1.7 Å

PDB Description: Crystal Structure of Mycobacterium tuberculosis NusA
PDB Compounds: (B:) NusA

SCOPe Domain Sequences for d1k0rb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0rb4 d.202.1.1 (B:-4-99) Transcription factor NusA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
vsrrhmnidmaalhaievdrgisvnelletiksalltayrhtqghqtdarieidrktgvv
rviaretdeagnlisewddtpegfgriaattarqvmlqrfrdae

SCOPe Domain Coordinates for d1k0rb4:

Click to download the PDB-style file with coordinates for d1k0rb4.
(The format of our PDB-style files is described here.)

Timeline for d1k0rb4: