Lineage for d1k0ra1 (1k0r A:108-183)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 800112Protein S1 domain of NusA [69265] (2 species)
  7. 800113Species Mycobacterium tuberculosis [TaxId:1773] [69267] (3 PDB entries)
  8. 800115Domain d1k0ra1: 1k0r A:108-183 [67961]
    Other proteins in same PDB: d1k0ra2, d1k0ra3, d1k0ra4, d1k0rb2, d1k0rb3, d1k0rb4

Details for d1k0ra1

PDB Entry: 1k0r (more details), 1.7 Å

PDB Description: Crystal Structure of Mycobacterium tuberculosis NusA
PDB Compounds: (A:) NusA

SCOP Domain Sequences for d1k0ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ra1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]}
stregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcyv
vgvtrgareplitlsr

SCOP Domain Coordinates for d1k0ra1:

Click to download the PDB-style file with coordinates for d1k0ra1.
(The format of our PDB-style files is described here.)

Timeline for d1k0ra1: