SCOP 1.63: Domain d1k0ob2: 1k0o B:6-89

Lineage for d1k0ob2 (1k0o B:6-89)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Chloride intracellular channel 1 (clic1) [69514] (1 species)
   similar to class theta enzymes

7. Species Human (Homo sapiens) [TaxId:9606] [69515] (3 PDB entries)

8. Domain d1k0ob2: 1k0o B:6-89 [67960]
   Other proteins in same PDB: d1k0oa1, d1k0ob1
   mutant

Details for d1k0ob2

PDB Entry: 1k0o, 1.75 Å

PDB Description: crystal structure of a soluble form of clic1. an intracellular chloride ion channel

SCOP Domain Sequences for d1k0ob2:

Sequence; same for both SEQRES and ATOM records:

>d1k0ob2 c.47.1.5 (B:6-89) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggelp
fllygtevhtdtnkieefleavlc

Timeline for d1k0ob2:

• d1k0ob2 first appeared in SCOP 1.59
  
• d1k0ob2 appears in SCOP 1.61
  
• d1k0ob2 appears in SCOP 1.65
  
• d1k0ob2 appears in the current release, SCOPe 2.08