SCOPe 2.04: Domain d1k0ob1: 1k0o B:92-241

Lineage for d1k0ob1 (1k0o B:92-241)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
   similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition

7. Species Human (Homo sapiens) [TaxId:9606] [69034] (4 PDB entries)

8. Domain d1k0ob1: 1k0o B:92-241 [67959]
   Other proteins in same PDB: d1k0oa2, d1k0ob2

Details for d1k0ob1

PDB Entry: 1k0o, 1.75 Å

PDB Description: crystal structure of a soluble form of clic1. an intracellular chloride ion channel

PDB Compounds: (B:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d1k0ob1:

Sequence, based on SEQRES records:

>d1k0ob1 a.45.1.1 (B:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakalk

Sequence, based on observed residues (ATOM records):

>d1k0ob1 a.45.1.1 (B:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalsntagldifakfsayiknsnpalndnlekgllkalkvldnyltspkfldgne
ltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeiela
yeqvakalk

Timeline for d1k0ob1:

• d1k0ob1 first appeared in SCOP 1.59
  
• d1k0ob1 appears in SCOPe 2.03
  
• d1k0ob1 appears in SCOPe 2.05
  
• d1k0ob1 appears in the current release, SCOPe 2.08