Lineage for d1k0na1 (1k0n A:92-241)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443397Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
    similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition
  7. 443398Species Human (Homo sapiens) [TaxId:9606] [69034] (4 PDB entries)
  8. 443405Domain d1k0na1: 1k0n A:92-241 [67953]
    Other proteins in same PDB: d1k0na2, d1k0nb2

Details for d1k0na1

PDB Entry: 1k0n (more details), 1.8 Å

PDB Description: chloride intracellular channel 1 (clic1) complexed with glutathione

SCOP Domain Sequences for d1k0na1:

Sequence, based on SEQRES records: (download)

>d1k0na1 a.45.1.1 (A:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakalk

Sequence, based on observed residues (ATOM records): (download)

>d1k0na1 a.45.1.1 (A:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
vsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayareefas
tcpddeeielayeqvakalk

SCOP Domain Coordinates for d1k0na1:

Click to download the PDB-style file with coordinates for d1k0na1.
(The format of our PDB-style files is described here.)

Timeline for d1k0na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k0na2