Lineage for d1k0ka_ (1k0k A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417123Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 417124Superfamily d.110.1: Profilin (actin-binding protein) [55770] (1 family) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 417125Family d.110.1.1: Profilin (actin-binding protein) [55771] (1 protein)
  6. 417126Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 417134Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55777] (2 PDB entries)
  8. 417137Domain d1k0ka_: 1k0k A: [67946]
    complexed with gol

Details for d1k0ka_

PDB Entry: 1k0k (more details), 2.35 Å

PDB Description: Yeast Profilin, Cubic Crystal Form

SCOP Domain Sequences for d1k0ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ka_ d.110.1.1 (A:) Profilin (actin-binding protein) {Baker's yeast (Saccharomyces cerevisiae)}
swqaytdnligtgkvdkaviysragdavwatsgglslqpneigeivqgfdnpaglqsngl
hiqgqkfmllraddrsiygrhdaegvvcvrtkqtviiahypptvqageatkiveqladyl
igvqy

SCOP Domain Coordinates for d1k0ka_:

Click to download the PDB-style file with coordinates for d1k0ka_.
(The format of our PDB-style files is described here.)

Timeline for d1k0ka_: