SCOP 1.69: Domain d1k0dd2: 1k0d D:99-200

Lineage for d1k0dd2 (1k0d D:99-200)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (15 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Yeast prion protein ure2p, nitrogen regulation fragment [52886] (1 species)
   similar to class phi enzymes

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52887] (8 PDB entries)

8. Domain d1k0dd2: 1k0d D:99-200 [67937]
   Other proteins in same PDB: d1k0da1, d1k0db1, d1k0dc1, d1k0dd1

Details for d1k0dd2

PDB Entry: 1k0d, 2.2 Å

PDB Description: Ure2p in Complex with Glutathione

SCOP Domain Sequences for d1k0dd2:

Sequence; same for both SEQRES and ATOM records:

>d1k0dd2 c.47.1.5 (D:99-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
ysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvs
vnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpl

Timeline for d1k0dd2:

• d1k0dd2 first appeared in SCOP 1.59
  
• d1k0dd2 appears in SCOP 1.67
  
• d1k0dd2 appears in SCOP 1.71
  
• d1k0dd2 appears in the current release, SCOPe 2.08