Lineage for d1k0cd1 (1k0c D:201-353)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281527Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 281528Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 281529Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 281876Protein Yeast prion protein ure2p, nitrogen regulation fragment [47641] (1 species)
    similar to class phi enzymes
  7. 281877Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47642] (8 PDB entries)
  8. 281897Domain d1k0cd1: 1k0c D:201-353 [67928]
    Other proteins in same PDB: d1k0ca2, d1k0cb2, d1k0cc2, d1k0cd2
    complexed with gtb, gtt

Details for d1k0cd1

PDB Entry: 1k0c (more details), 2.5 Å

PDB Description: Ure2p in complex with S-p-nitrobenzylglutathione

SCOP Domain Sequences for d1k0cd1:

Sequence, based on SEQRES records: (download)

>d1k0cd1 a.45.1.1 (D:201-353) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmeldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvv
driginikiefpevykwtkhmmrrpavikalrg

Sequence, based on observed residues (ATOM records): (download)

>d1k0cd1 a.45.1.1 (D:201-353) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmeldffdypvwlvgdkltiadlafvpwnnvvdriginikiefpevykwt
khmmrrpavikalrg

SCOP Domain Coordinates for d1k0cd1:

Click to download the PDB-style file with coordinates for d1k0cd1.
(The format of our PDB-style files is described here.)

Timeline for d1k0cd1: