Lineage for d1k0cc2 (1k0c C:100-200)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181295Protein Yeast prion protein ure2p, nitrogen regulation fragment [52886] (1 species)
  7. 181296Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52887] (8 PDB entries)
  8. 181315Domain d1k0cc2: 1k0c C:100-200 [67927]
    Other proteins in same PDB: d1k0ca1, d1k0cb1, d1k0cc1, d1k0cd1

Details for d1k0cc2

PDB Entry: 1k0c (more details), 2.5 Å

PDB Description: Ure2p in complex with S-p-nitrobenzylglutathione

SCOP Domain Sequences for d1k0cc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0cc2 c.47.1.5 (C:100-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
sritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsv
npnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpl

SCOP Domain Coordinates for d1k0cc2:

Click to download the PDB-style file with coordinates for d1k0cc2.
(The format of our PDB-style files is described here.)

Timeline for d1k0cc2: