Lineage for d1k01l_ (1k01 L:)
- Root: SCOP 1.59
Class i: Low resolution protein structures [58117] (16 folds) 
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) 
- Family i.1.1.2: Large subunit [58124] (3 proteins)
- Protein 50S subunit [58125] (3 species)
- Species Deinococcus radiodurans [TaxId:1299] [69993] (6 PDB entries)
Domain d1k01l_: 1k01 L: [67902]
Details for d1k01l_
PDB Entry: 1k01 (more details), 3.5 Å
PDB Description: Structural Basis for the Interaction of Antibiotics with the Peptidyl Transferase Center in Eubacteria
SCOP Domain Sequences for d1k01l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k01l_ i.1.1.2 (L:) 50S subunit {Deinococcus radiodurans}
eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
tiivaekgnk
SCOP Domain Coordinates for d1k01l_:
Click to download the PDB-style file with coordinates for d1k01l_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k01l_:
- d1k01l_ is new in SCOP 1.59
- d1k01l_ appears in SCOP 1.61
- d1k01l_ appears in the current release, SCOPe 2.08
View in 3D
