SCOPe 2.05: Domain d1k01k_: 1k01 K:

Lineage for d1k01k_ (1k01 K:)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Prokaryotic (50S subunit) [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1k01k_: 1k01 K: [67901]
   complexed with clm, mg

Details for d1k01k_

PDB Entry: 1k01, 3.5 Å

PDB Description: Structural Basis for the Interaction of Antibiotics with the Peptidyl Transferase Center in Eubacteria

PDB Compounds: (K:) ribosomal protein l4

SCOPe Domain Sequences for d1k01k_:

Sequence; same for both SEQRES and ATOM records:

>d1k01k_ i.1.1.2 (K:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

Timeline for d1k01k_:

• d1k01k_ first appeared in SCOP 1.59
  
• d1k01k_ appears in SCOPe 2.04
  
• d1k01k_ appears in SCOPe 2.06
  
• d1k01k_ appears in the current release, SCOPe 2.08