Lineage for d1k01k_ (1k01 K:)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2592941Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2592942Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2593959Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 2594094Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 2594095Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 2594199Domain d1k01k_: 1k01 K: [67901]
    complexed with clm, mg

Details for d1k01k_

PDB Entry: 1k01 (more details), 3.5 Å

PDB Description: Structural Basis for the Interaction of Antibiotics with the Peptidyl Transferase Center in Eubacteria
PDB Compounds: (K:) ribosomal protein l4

SCOPe Domain Sequences for d1k01k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k01k_ i.1.1.2 (K:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

SCOPe Domain Coordinates for d1k01k_:

Click to download the PDB-style file with coordinates for d1k01k_.
(The format of our PDB-style files is described here.)

Timeline for d1k01k_: