Lineage for d1jzxl_ (1jzx L:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1468643Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1468644Protein 50S subunit [58125] (6 species)
  7. 1468645Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1468705Domain d1jzxl_: 1jzx L: [67886]
    complexed with cly, mg

Details for d1jzxl_

PDB Entry: 1jzx (more details), 3.1 Å

PDB Description: Structural Basis for the Interaction of Antibiotics with the Peptidyl Transferase Center in Eubacteria
PDB Compounds: (L:) ribosomal protein l22

SCOPe Domain Sequences for d1jzxl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzxl_ i.1.1.2 (L:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
tiivaekgnk

SCOPe Domain Coordinates for d1jzxl_:

Click to download the PDB-style file with coordinates for d1jzxl_.
(The format of our PDB-style files is described here.)

Timeline for d1jzxl_: