SCOP 1.75: Domain d1jzxl_: 1jzx L:

Lineage for d1jzxl_ (1jzx L:)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1jzxl_: 1jzx L: [67886]

Details for d1jzxl_

PDB Entry: 1jzx, 3.1 Å

PDB Description: Structural Basis for the Interaction of Antibiotics with the Peptidyl Transferase Center in Eubacteria

PDB Compounds: (L:) ribosomal protein l22

SCOP Domain Sequences for d1jzxl_:

Sequence; same for both SEQRES and ATOM records:

>d1jzxl_ i.1.1.2 (L:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
tiivaekgnk

Timeline for d1jzxl_:

• d1jzxl_ first appeared in SCOP 1.59
  
• d1jzxl_ appears in SCOP 1.73
  
• d1jzxl_ appears in SCOPe 2.01
  
• d1jzxl_ appears in the current release, SCOPe 2.08