Lineage for d1jzxk_ (1jzx K:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1249271Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1249272Protein 50S subunit [58125] (6 species)
  7. 1249275Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1249334Domain d1jzxk_: 1jzx K: [67885]
    complexed with cly, mg

Details for d1jzxk_

PDB Entry: 1jzx (more details), 3.1 Å

PDB Description: Structural Basis for the Interaction of Antibiotics with the Peptidyl Transferase Center in Eubacteria
PDB Compounds: (K:) ribosomal protein l4

SCOPe Domain Sequences for d1jzxk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzxk_ i.1.1.2 (K:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

SCOPe Domain Coordinates for d1jzxk_:

Click to download the PDB-style file with coordinates for d1jzxk_.
(The format of our PDB-style files is described here.)

Timeline for d1jzxk_: