Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) |
Family c.1.8.3: beta-glycanases [51487] (16 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (1 species) |
Species Escherichia coli [TaxId:562] [51511] (23 PDB entries) |
Domain d1jz8b5: 1jz8 B:334-625 [67839] Other proteins in same PDB: d1jz8a1, d1jz8a2, d1jz8a3, d1jz8a4, d1jz8b1, d1jz8b2, d1jz8b3, d1jz8b4, d1jz8c1, d1jz8c2, d1jz8c3, d1jz8c4, d1jz8d1, d1jz8d2, d1jz8d3, d1jz8d4 |
PDB Entry: 1jz8 (more details), 1.5 Å
SCOP Domain Sequences for d1jz8b5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz8b5 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1jz8b5:
View in 3D Domains from same chain: (mouse over for more information) d1jz8b1, d1jz8b2, d1jz8b3, d1jz8b4 |