Lineage for d1jz5d5 (1jz5 D:334-625)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1145755Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1145839Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 1145847Species Escherichia coli [TaxId:562] [51511] (25 PDB entries)
    Uniprot P00722
  8. 1145887Domain d1jz5d5: 1jz5 D:334-625 [67789]
    Other proteins in same PDB: d1jz5a1, d1jz5a2, d1jz5a3, d1jz5a4, d1jz5b1, d1jz5b2, d1jz5b3, d1jz5b4, d1jz5c1, d1jz5c2, d1jz5c3, d1jz5c4, d1jz5d1, d1jz5d2, d1jz5d3, d1jz5d4
    complexed with 149, dms, mg, na

Details for d1jz5d5

PDB Entry: 1jz5 (more details), 1.8 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with d-galctopyranosyl-1- on
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1jz5d5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz5d5 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1jz5d5:

Click to download the PDB-style file with coordinates for d1jz5d5.
(The format of our PDB-style files is described here.)

Timeline for d1jz5d5: