Lineage for d1jz3b5 (1jz3 B:334-625)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1818879Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 1818887Species Escherichia coli [TaxId:562] [51511] (42 PDB entries)
    Uniprot P00722
  8. 1818913Domain d1jz3b5: 1jz3 B:334-625 [67739]
    Other proteins in same PDB: d1jz3a1, d1jz3a2, d1jz3a3, d1jz3a4, d1jz3b1, d1jz3b2, d1jz3b3, d1jz3b4, d1jz3c1, d1jz3c2, d1jz3c3, d1jz3c4, d1jz3d1, d1jz3d2, d1jz3d3, d1jz3d4
    complexed with 2dg, btb, dms, mg, na

Details for d1jz3b5

PDB Entry: 1jz3 (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-deoxy-galactosyl enzyme intermediate
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1jz3b5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz3b5 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1jz3b5:

Click to download the PDB-style file with coordinates for d1jz3b5.
(The format of our PDB-style files is described here.)

Timeline for d1jz3b5: