Class b: All beta proteins [48724] (176 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
Protein beta-Galactosidase, domain 5 [49996] (2 species) |
Species Escherichia coli [TaxId:562] [49997] (42 PDB entries) Uniprot P00722 |
Domain d1jz3b4: 1jz3 B:731-1023 [67738] Other proteins in same PDB: d1jz3a1, d1jz3a2, d1jz3a3, d1jz3a5, d1jz3b1, d1jz3b2, d1jz3b3, d1jz3b5, d1jz3c1, d1jz3c2, d1jz3c3, d1jz3c5, d1jz3d1, d1jz3d2, d1jz3d3, d1jz3d5 complexed with 2dg, btb, dms, mg, na |
PDB Entry: 1jz3 (more details), 1.75 Å
SCOPe Domain Sequences for d1jz3b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jz3b4 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1jz3b4:
View in 3D Domains from same chain: (mouse over for more information) d1jz3b1, d1jz3b2, d1jz3b3, d1jz3b5 |