Lineage for d1jz2c3 (1jz2 C:13-219)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530315Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1530316Protein beta-Galactosidase [49804] (2 species)
  7. 1530324Species Escherichia coli [TaxId:562] [49805] (41 PDB entries)
    Uniprot P00722
  8. 1530407Domain d1jz2c3: 1jz2 C:13-219 [67722]
    Other proteins in same PDB: d1jz2a1, d1jz2a2, d1jz2a4, d1jz2a5, d1jz2b1, d1jz2b2, d1jz2b4, d1jz2b5, d1jz2c1, d1jz2c2, d1jz2c4, d1jz2c5, d1jz2d1, d1jz2d2, d1jz2d4, d1jz2d5
    complexed with 2fg, btb, dms, mg, na

Details for d1jz2c3

PDB Entry: 1jz2 (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate (orthorhombic)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jz2c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz2c3 b.18.1.5 (C:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1jz2c3:

Click to download the PDB-style file with coordinates for d1jz2c3.
(The format of our PDB-style files is described here.)

Timeline for d1jz2c3: