Lineage for d1jz1l4 (1jz1 L:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781621Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2781622Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2781630Species Escherichia coli [TaxId:562] [49997] (46 PDB entries)
    Uniprot P00722
  8. 2781790Domain d1jz1l4: 1jz1 L:731-1023 [67688]
    Other proteins in same PDB: d1jz1i1, d1jz1i2, d1jz1i3, d1jz1i5, d1jz1j1, d1jz1j2, d1jz1j3, d1jz1j5, d1jz1k1, d1jz1k2, d1jz1k3, d1jz1k5, d1jz1l1, d1jz1l2, d1jz1l3, d1jz1l5, d1jz1m1, d1jz1m2, d1jz1m3, d1jz1m5, d1jz1n1, d1jz1n2, d1jz1n3, d1jz1n5, d1jz1o1, d1jz1o2, d1jz1o3, d1jz1o5, d1jz1p1, d1jz1p2, d1jz1p3, d1jz1p5
    complexed with 2fg, mg, na
    complexed with 2fg, mg, na

Details for d1jz1l4

PDB Entry: 1jz1 (more details), 2.6 Å

PDB Description: e. coli (lacz) beta-galactosidase-trapped 2-f-galactosyl-enzyme intermediate. chains i-p, see remark 400
PDB Compounds: (L:) beta-galactosidase

SCOPe Domain Sequences for d1jz1l4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jz1l4 b.30.5.1 (L:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1jz1l4:

Click to download the PDB-style file with coordinates for d1jz1l4.
(The format of our PDB-style files is described here.)

Timeline for d1jz1l4: