SCOPe 2.08: Domain d1jyyd5: 1jyy D:334-625

Lineage for d1jyyd5 (1jyy D:334-625)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein beta-Galactosidase, domain 3 [51510] (3 species)

7. Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
   Uniprot P00722

8. Domain d1jyyd5: 1jyy D:334-625 [67569]
   Other proteins in same PDB: d1jyya1, d1jyya2, d1jyya3, d1jyya4, d1jyyb1, d1jyyb2, d1jyyb3, d1jyyb4, d1jyyc1, d1jyyc2, d1jyyc3, d1jyyc4, d1jyyd1, d1jyyd2, d1jyyd3, d1jyyd4, d1jyye1, d1jyye2, d1jyye3, d1jyye4, d1jyyf1, d1jyyf2, d1jyyf3, d1jyyf4, d1jyyg1, d1jyyg2, d1jyyg3, d1jyyg4, d1jyyh1, d1jyyh2, d1jyyh3, d1jyyh4
   complexed with 2fl, mg, na
   complexed with 2fl, mg, na

Details for d1jyyd5

PDB Entry: 1jyy, 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase in complex with 2-f-lactose. chains a-h, see remark 400.

PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1jyyd5:

Sequence; same for both SEQRES and ATOM records:

>d1jyyd5 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

Timeline for d1jyyd5:

• d1jyyd5 first appeared in SCOP 1.59
  
• d1jyyd5 appears in SCOPe 2.07