Lineage for d1jyxd1 (1jyx D:220-333)
- Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) Species Escherichia coli [TaxId:562] [49306] (23 PDB entries) 
Domain d1jyxd1: 1jyx D:220-333 [67545]
Other proteins in same PDB: d1jyxa3, d1jyxa4, d1jyxa5, d1jyxb3, d1jyxb4, d1jyxb5, d1jyxc3, d1jyxc4, d1jyxc5, d1jyxd3, d1jyxd4, d1jyxd5
Details for d1jyxd1
PDB Entry: 1jyx (more details), 1.75 Å
PDB Description: e. coli (lacz) beta-galactosidase in complex with iptg
SCOP Domain Sequences for d1jyxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyxd1 b.1.4.1 (D:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
SCOP Domain Coordinates for d1jyxd1:
Click to download the PDB-style file with coordinates for d1jyxd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jyxd1:
- d1jyxd1 first appeared in SCOP 1.59
- d1jyxd1 appears in SCOP 1.63
- d1jyxd1 appears in SCOP 1.67
- d1jyxd1 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1jyxd2, d1jyxd3, d1jyxd4, d1jyxd5 |
