Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (2 species) |
Species Escherichia coli [TaxId:562] [51511] (41 PDB entries) Uniprot P00722 |
Domain d1jyxc5: 1jyx C:334-625 [67544] Other proteins in same PDB: d1jyxa1, d1jyxa2, d1jyxa3, d1jyxa4, d1jyxb1, d1jyxb2, d1jyxb3, d1jyxb4, d1jyxc1, d1jyxc2, d1jyxc3, d1jyxc4, d1jyxd1, d1jyxd2, d1jyxd3, d1jyxd4 complexed with dms, ipt, mg, na |
PDB Entry: 1jyx (more details), 1.75 Å
SCOPe Domain Sequences for d1jyxc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyxc5 c.1.8.3 (C:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1jyxc5:
View in 3D Domains from same chain: (mouse over for more information) d1jyxc1, d1jyxc2, d1jyxc3, d1jyxc4 |