Lineage for d1jywc3 (1jyw C:13-219)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530315Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1530316Protein beta-Galactosidase [49804] (2 species)
  7. 1530324Species Escherichia coli [TaxId:562] [49805] (41 PDB entries)
    Uniprot P00722
  8. 1530335Domain d1jywc3: 1jyw C:13-219 [67522]
    Other proteins in same PDB: d1jywa1, d1jywa2, d1jywa4, d1jywa5, d1jywb1, d1jywb2, d1jywb4, d1jywb5, d1jywc1, d1jywc2, d1jywc4, d1jywc5, d1jywd1, d1jywd2, d1jywd4, d1jywd5
    complexed with 147, dms, mg, na

Details for d1jywc3

PDB Entry: 1jyw (more details), 1.55 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with pnpg
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jywc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jywc3 b.18.1.5 (C:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1jywc3:

Click to download the PDB-style file with coordinates for d1jywc3.
(The format of our PDB-style files is described here.)

Timeline for d1jywc3: