Lineage for d1jyvc4 (1jyv C:731-1023)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1534928Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1535067Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1535068Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 1535069Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 1535077Species Escherichia coli [TaxId:562] [49997] (41 PDB entries)
    Uniprot P00722
  8. 1535120Domain d1jyvc4: 1jyv C:731-1023 [67503]
    Other proteins in same PDB: d1jyva1, d1jyva2, d1jyva3, d1jyva5, d1jyvb1, d1jyvb2, d1jyvb3, d1jyvb5, d1jyvc1, d1jyvc2, d1jyvc3, d1jyvc5, d1jyvd1, d1jyvd2, d1jyvd3, d1jyvd5
    complexed with 145, dms, mg, na

Details for d1jyvc4

PDB Entry: 1jyv (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (e537q) in complex with onpg
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d1jyvc4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyvc4 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1jyvc4:

Click to download the PDB-style file with coordinates for d1jyvc4.
(The format of our PDB-style files is described here.)

Timeline for d1jyvc4: