Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (2 species) |
Species Escherichia coli [TaxId:562] [51511] (42 PDB entries) Uniprot P00722 |
Domain d1jyvb5: 1jyv B:334-625 [67499] Other proteins in same PDB: d1jyva1, d1jyva2, d1jyva3, d1jyva4, d1jyvb1, d1jyvb2, d1jyvb3, d1jyvb4, d1jyvc1, d1jyvc2, d1jyvc3, d1jyvc4, d1jyvd1, d1jyvd2, d1jyvd3, d1jyvd4 complexed with 145, dms, mg, na |
PDB Entry: 1jyv (more details), 1.75 Å
SCOPe Domain Sequences for d1jyvb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyvb5 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilcqyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1jyvb5:
View in 3D Domains from same chain: (mouse over for more information) d1jyvb1, d1jyvb2, d1jyvb3, d1jyvb4 |