Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
Domain d1jync2: 1jyn C:626-730 [67474] Other proteins in same PDB: d1jyna3, d1jyna4, d1jyna5, d1jynb3, d1jynb4, d1jynb5, d1jync3, d1jync4, d1jync5, d1jynd3, d1jynd4, d1jynd5 complexed with dms, mg, na |
PDB Entry: 1jyn (more details), 1.8 Å
SCOPe Domain Sequences for d1jync2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jync2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1jync2:
View in 3D Domains from same chain: (mouse over for more information) d1jync1, d1jync3, d1jync4, d1jync5 |