Lineage for d1jyga_ (1jyg A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282277Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 282590Superfamily a.60.11: Hypothetical protein YjbJ [69047] (1 family) (S)
  5. 282591Family a.60.11.1: Hypothetical protein YjbJ [69048] (1 protein)
  6. 282592Protein Hypothetical protein YjbJ [69049] (1 species)
  7. 282593Species Escherichia coli [TaxId:562] [69050] (1 PDB entry)
  8. 282594Domain d1jyga_: 1jyg A: [67457]

Details for d1jyga_

PDB Entry: 1jyg (more details)

PDB Description: Solution Structure of hypothetical protein Yjbj_ecoli

SCOP Domain Sequences for d1jyga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jyga_ a.60.11.1 (A:) Hypothetical protein YjbJ {Escherichia coli}
mnkdeaggnwkqfkgkvkeqwgkltdddmtiiegkrdqlvgkiqerygyqkdqaekevvd
wetrneyrw

SCOP Domain Coordinates for d1jyga_:

Click to download the PDB-style file with coordinates for d1jyga_.
(The format of our PDB-style files is described here.)

Timeline for d1jyga_: