Lineage for d1jyea_ (1jye A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) 
Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins) 
Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species) Species Escherichia coli [TaxId:562] [53838] (8 PDB entries) 
Domain d1jyea_: 1jye A: [67455]
Details for d1jyea_
PDB Entry: 1jye (more details), 1.7 Å
PDB Description: structure of a dimeric lac repressor with c-terminal deletion and k84l substitution
SCOP Domain Sequences for d1jyea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli}
lligvatsslalhapsqivaailsradqlgasvvvsmversgveacktavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttlap
SCOP Domain Coordinates for d1jyea_:
Click to download the PDB-style file with coordinates for d1jyea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jyea_:
- d1jyea_ is new in SCOP 1.59
- d1jyea_ appears in SCOP 1.61
- d1jyea_ appears in the current release, SCOPe 2.08
View in 3D