Lineage for d1jy3s_ (1jy3 S:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266165Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 2266166Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 2266278Protein Fibrinogen gamma chain [88898] (4 species)
  7. 2266282Species Cow (Bos taurus) [TaxId:9913] [88901] (2 PDB entries)
  8. 2266286Domain d1jy3s_: 1jy3 S: [67451]
    Other proteins in same PDB: d1jy3n_, d1jy3o_, d1jy3q_, d1jy3r_
    central region only (e5 fragment)

Details for d1jy3s_

PDB Entry: 1jy3 (more details), 1.6 Å

PDB Description: crystal structure of the central region of bovine fibrinogen (e5 fragment) at 1.4 angstroms resolution
PDB Compounds: (S:) fibrinogen gamma-b chain

SCOPe Domain Sequences for d1jy3s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jy3s_ h.1.8.1 (S:) Fibrinogen gamma chain {Cow (Bos taurus) [TaxId: 9913]}
vatrdnccilderfgsycpttcgiadflnnyqtsvdkdlrtlegily

SCOPe Domain Coordinates for d1jy3s_:

Click to download the PDB-style file with coordinates for d1jy3s_.
(The format of our PDB-style files is described here.)

Timeline for d1jy3s_: