Lineage for d1jx6a_ (1jx6 A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186118Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
  4. 186119Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
  5. 186120Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins)
  6. 186240Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species)
  7. 186241Species Vibrio harveyi [TaxId:669] [69623] (1 PDB entry)
  8. 186242Domain d1jx6a_: 1jx6 A: [67406]

Details for d1jx6a_

PDB Entry: 1jx6 (more details), 1.5 Å

PDB Description: crystal structure of luxp from vibrio harveyi complexed with autoinducer-2

SCOP Domain Sequences for d1jx6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi}
gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni
asfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfveh
vldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyf
segyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacst
dvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwd
ledkpvptvysgdfeivtkadsperiealkkrafrysd

SCOP Domain Coordinates for d1jx6a_:

Click to download the PDB-style file with coordinates for d1jx6a_.
(The format of our PDB-style files is described here.)

Timeline for d1jx6a_: