Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) |
Family c.93.1.1: L-arabinose binding protein-like [53823] (13 proteins) |
Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species) |
Species Vibrio harveyi [TaxId:669] [69623] (1 PDB entry) |
Domain d1jx6a_: 1jx6 A: [67406] |
PDB Entry: 1jx6 (more details), 1.5 Å
SCOP Domain Sequences for d1jx6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi} gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni asfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfveh vldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyf segyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacst dvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwd ledkpvptvysgdfeivtkadsperiealkkrafrysd
Timeline for d1jx6a_: