Lineage for d1jx4a_ (1jx4 A:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339256Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 339257Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 339520Family e.8.1.5: Lesion bypass DNA polymerase (Y-family) [64477] (2 proteins)
  6. 339521Protein DinB homolog (DBH) [64478] (2 species)
  7. 339527Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [69879] (2 PDB entries)
  8. 339528Domain d1jx4a_: 1jx4 A: [67405]
    complexed with adi, ca, mg

Details for d1jx4a_

PDB Entry: 1jx4 (more details), 1.7 Å

PDB Description: Crystal Structure of a Y-family DNA Polymerase in a Ternary Complex with DNA Substrates and an Incoming Nucleotide

SCOP Domain Sequences for d1jx4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jx4a_ e.8.1.5 (A:) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV}
mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

SCOP Domain Coordinates for d1jx4a_:

Click to download the PDB-style file with coordinates for d1jx4a_.
(The format of our PDB-style files is described here.)

Timeline for d1jx4a_: